---
widget:
- text: "MEPLDDLDLLLLEEDSGAEAVPRMEILQKKADAFFAETVLSRGVDNRYLVLAVETKLNERGAEEKHLLITVSQEGEQEVLCILRNGWSSVPVEPGDIIHIEGDCTSEPWIVDDDFGYFILSPDMLISGTSVASSIRCLRRAVLSETFRVSDTATRQMLIGTILHEVFQKAISESFAPEKLQELALQTLREVRHLKEMYRLNLSQDEVRCEVEEYLPSFSKWADEFMHKGTKAEFPQMHLSLPSDSSDRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTVGVKIHRDCKTKYKIMPLELKTGKESNSIEHRGQVILYTLLSQERREDPEAGWLLYLKTGQMYPVPANHLDKRELLKLRNQLAFSLLHRVSRAAAGEEARLLALPQIIEEEKTCKYCSQMGNCALYSRAVEQVHDTSIPEGMRSKIQEGTQHLTRAHLKYFSLWCLMLTLESQSKDTKKSHQSIWLTPASKLEESGNCIGSLVRTEPVKRVCDGHYLHNFQRKNGPMPATNLMAGDRIILSGEERKLFALSKGYVKRIDTAAVTCLLDRNLSTLPETTLFRLDREEKHGDINTPLGNLSKLMENTDSSKRLRELIIDFKEPQFIAYLSSVLPHDAKDTVANILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICALVRILSACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLGQSHKVHPDIQKFTEEEMCRLRSIASLAHLEELYNSHPVVATTCMGISHPMFSRKTFDFCIVDEASQISQPICLGPLFFSRRFVLVGDHKQLPPLVLNREARALGMSESLFKRLERNESAVVQLTIQYRMNRKIMSLSNKLTYEGKLECGSDRVANAVITLPNLKDVRLEFYADYSDNPWLAGVFEPDNPVCFLNTDKVPAPEQIENGGVSNVTEARLIVFLTSTFIKAGCSPSDIGIIAPYRQQLRTITDLLARSSVGMVEVNTVDKYQGRDKSLILVSFVRSNEDGTLGELLKDWRRLNVAITRAKHKLILLGSVSSLKRF"
  example_title: "Protein Sequence 1"
- text: "MNSVTVSHAPYYIVYHDDWEPVMSQLVEFYNEVASWLLRDETSPIPPKFFIQLKQMLRNKRVCVCGILPYPIDGTGVPFESPNFTKKSIKEIASSISRLTGVIDYKGYNLNIIDGVIPWNYYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDFSNIRAKLESPVTTIVGYHPAARDRQFEKDRSFEIINELLELDNKVPINWAQGFIY"
  example_title: "Protein Sequence 2"
- text: "MNSVTVSHAPYTIAYHDDWEPVMSQLVEFYNEAASWLLRDETSPIPSKFNIQLKQPLRNKRVCVFGIDPYPKDGTGVPFESPNFTKKSIKEIASSISRLMGVIDYEGYNLNIIDGVIPWNYYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDFSNIRAKLESPVTTIVGYHPSARDRQFEKDRSFEIINVLLELDNKVPLNWAQGFIY"
  example_title: "Protein Sequence 3"
license: mit
datasets:
- AmelieSchreiber/general_binding_sites
language:
- en
metrics:
- precision
- recall
- f1
library_name: transformers
tags:
- biology
- esm
- esm2
- ESM-2
- protein language model
---

# ESM-2 for General Protein Binding Site Prediction

This model is trained to predict general binding sites of proteins using on the sequence. This is a finetuned version of 
`esm2_t6_8M_UR50D`, trained on [this dataset](https://huggingface.co/datasets/AmelieSchreiber/general_binding_sites). The data is 
not filtered by family, and thus the model may be overfit to some degree. In the Hugging Face Inference API widget to the right 
there are three protein sequence examples. The first is a DNA binding protein truncated to the first 1022 amino acid residues
([see UniProt entry here](https://www.uniprot.org/uniprotkb/D3ZG52/entry)). 

The second and third were obtained using [EvoProtGrad](https://github.com/Amelie-Schreiber/sampling_protein_language_models/blob/main/EvoProtGrad_copy.ipynb)
a Markov Chain Monte Carlo method of (in silico) directed evolution of proteins based on a form of Gibbs sampling. The mutatant-type 
protein sequences in theory should have similar binding sites to the wild-type protein sequence, but perhaps with higher binding affinity. 
Testing this out on the model, we see the two proteins indeed have the same binding sites, which validates to some degree that the model 
has learned to predict binding sites well (and that EvoProtGrad works as intended). 

## Training

```
epoch 3:
Training Loss Validation Loss Precision	Recall	 F1	      Auc
0.031100	  0.074720	      0.684798	0.966856 0.801743 0.980853
```

```
wandb: 	lr: 0.0004977045729600779
wandb: 	lr_scheduler_type: cosine
wandb: 	max_grad_norm: 0.5
wandb: 	num_train_epochs: 3
wandb: 	per_device_train_batch_size: 8
wandb: 	weight_decay: 0.025
```

## Using the Model

Try pasting a protein sequence into the cell on the right and clicking on "Compute". For example, try

```
MNSVTVSHAPYTIAYHDDWEPVMSQLVEFYNEAASWLLRDETSPIPSKFNIQLKQPLRNKRVCVFGIDPYPKDGTGVPFESPNFTKKSIKEIASSISRLMGVIDYEGYNLNIIDGVIPWNYYLSCKLGETKSHAIYWDKISKLLLQHITKHVSVLYCLGKTDFSNIRAKLESPVTTIVGYHPSARDRQFEKDRSFEIINVLLELDNKVPLNWAQGFIY
```

To use the model, try running:
```python
import torch
from transformers import AutoModelForTokenClassification, AutoTokenizer

def predict_binding_sites(model_path, protein_sequences):
    """
    Predict binding sites for a collection of protein sequences.

    Parameters:
    - model_path (str): Path to the saved model.
    - protein_sequences (List[str]): List of protein sequences.

    Returns:
    - List[List[str]]: Predicted labels for each sequence.
    """

    # Load tokenizer and model
    tokenizer = AutoTokenizer.from_pretrained(model_path)
    model = AutoModelForTokenClassification.from_pretrained(model_path)

    # Ensure model is in evaluation mode
    model.eval()

    # Tokenize sequences
    inputs = tokenizer(protein_sequences, return_tensors="pt", padding=True, truncation=True)

    # Move to the same device as model and obtain logits
    with torch.no_grad():
        logits = model(**inputs).logits

    # Obtain predicted labels
    predicted_labels = torch.argmax(logits, dim=-1).cpu().numpy()

    # Convert label IDs to human-readable labels
    id2label = model.config.id2label
    human_readable_labels = [[id2label[label_id] for label_id in sequence] for sequence in predicted_labels]

    return human_readable_labels

# Usage:
model_path = "AmelieSchreiber/esm2_t6_8M_general_binding_sites_v2"  # Replace with your model's path
unseen_proteins = [
    "MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIDVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPSLGFFKPKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD", 
    "MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEYVFVGSYARNTWLKGSLEIAVFLLFPEEFSKEELRERGLEIGKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKWLEGRIKGKENEVRLLKGFLKANGIYGAEYKVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPSLGFFKVKHPLEIEPERLRKIVEERGTAVFAVKFRKPDIVDDNLYPQLERASRKIFEFLERENFMPLRSAFKASEEFCYLLFECQIKEISRVFRRMGPQFEDERNVKKFLSRNRAFRPFIENGRWWAFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFEIISGEKLFKEPVTAELCEMMGVKD", 
    "MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEAVFVGSYARNTWLKGSLEIAVFLLFPEEFSKEELRERGLEIEKAVLDSYEIRYAEHPYVHGVVKGVEVDVVPCYKLKEPKNIKSAVDRTPFHHKELEGRIKGKENEVRLLKGFLKANGIYGAEYAVRGFSGYLCELLIVFYGSFLETVKNARRWTRRTVIDVAKGEVRKGEEFFVVDPVDEKRNVAANLSLDNLARFVHLCREFMEAPSLGFFKVKHPLEIEPERLRKIVEERGTAVFMVKFRKPDIVDDNLYPQLRRASRKIFEFLERNNFMPLRSAFKASEEFCYLLFECQIKEISDVFRRMGPLFEDERNVKKFLSRNRALRPFIENGRWWIFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFEIISGEKLFKEPVTAELCRMMGVKD", 
    "MKVEEILEKALELVIPDEEEVRKGREAEEELRRRLDELGVEAVFVGSYARNTWLKGSLEIAVFLLFPEEFSKEELRERGLEIEKAVLDSYGIRYAEHPYVHGVVKGVELDVVPCYKLKEPKNIKSAVDRTPFHHKELEGRIKGKENEYRSLKGFLKANGIYGAEYAVRGFSGYLCELLIVFYGSFLETVKNARRWTRKTVIDVAKGEVRKGEEFFVVDPVDEKRNVAALLSLDNLARFVHLCREFMEAVSLGFFKVKHPLEIEPERLRKIVEERGTAVFMVKFRKPDIVDDNLYPQLRRASRKIFEFLERNNFMPLRRAFKASEEFCYLLFEQQIKEISDVFRRMGPLFEDERNVKKFLSRNRALRPFIENGRWWIFEMRKFTTPEEGVRSYASTHWHTLGKNVGESIREYFEIIEGEKLFKEPVTAELCRMMGVKD"
]  # Replace with your unseen protein sequences
predictions = predict_binding_sites(model_path, unseen_proteins)
predictions
```